CYP2C18 antibody (70R-5409)

Rabbit polyclonal CYP2C18 antibody raised against the N terminal of CYP2C18

Synonyms Polyclonal CYP2C18 antibody, Anti-CYP2C18 antibody, CYP2C antibody, P450IIC17 antibody, CYPC18-2, CYP2C18, Cytochrome P450 Family 2 Subfamily C Polypeptide 18 antibody, CPCI antibody, CYPC18-2 antibody, CYPC18 2, DKFZp686I24235 antibody, P450-6B/29C antibody, CYPC18 2 antibody, CYP2C17 antibody
Specificity CYP2C18 antibody was raised against the N terminal of CYP2C18
Cross Reactivity Human
Applications WB
Immunogen CYP2C18 antibody was raised using the N terminal of CYP2C18 corresponding to a region with amino acids MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM
Assay Information CYP2C18 Blocking Peptide, catalog no. 33R-5855, is also available for use as a blocking control in assays to test for specificity of this CYP2C18 antibody

Images

Western Blot analysis using CYP2C18 antibody (70R-5409)

CYP2C18 antibody (70R-5409) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP2C18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYP2C18 antibody (70R-5409) | CYP2C18 antibody (70R-5409) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors