Cytokeratin 13 antibody (70R-1178)

Rabbit polyclonal Cytokeratin 13 antibody raised against the C terminal of KRT13

Synonyms Polyclonal Cytokeratin 13 antibody, Anti-Cytokeratin 13 antibody, MGC3781 antibody, K13 antibody, Keratin 13 antibody, CK13 antibody, Cytokeratin -13 antibody, KRT13 antibody, Cytokeratin 13 antibody, Cytokeratin -13, Cytokeratin 13, MGC161462 antibody, Cytokeratin 13
Specificity Cytokeratin 13 antibody was raised against the C terminal of KRT13
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Cytokeratin 13 antibody was raised using the C terminal of KRT13 corresponding to a region with amino acids EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP
Assay Information Cytokeratin 13 Blocking Peptide, catalog no. 33R-2277, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 13 antibody


Western Blot analysis using Cytokeratin 13 antibody (70R-1178)

Cytokeratin 13 antibody (70R-1178) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KRT13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Cytokeratin 13 antibody (70R-1178) | Cytokeratin 13 antibody (70R-1178) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors