DAZL antibody (70R-4671)

Rabbit polyclonal DAZL antibody raised against the C terminal of DAZL

Synonyms Polyclonal DAZL antibody, Anti-DAZL antibody, Deleted In Azoospermia-Like antibody, MGC26406 antibody, DAZLA antibody, DAZH antibody, DAZL1 antibody, SPGYLA antibody
Specificity DAZL antibody was raised against the C terminal of DAZL
Cross Reactivity Human
Applications WB
Immunogen DAZL antibody was raised using the C terminal of DAZL corresponding to a region with amino acids EVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLR
Assay Information DAZL Blocking Peptide, catalog no. 33R-2778, is also available for use as a blocking control in assays to test for specificity of this DAZL antibody


Western Blot analysis using DAZL antibody (70R-4671)

DAZL antibody (70R-4671) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DAZL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DAZ (Deleted in AZoospermia) is the potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DAZL antibody (70R-4671) | DAZL antibody (70R-4671) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors