DBI antibody (70R-2557)

Rabbit polyclonal DBI antibody

Synonyms Polyclonal DBI antibody, Anti-DBI antibody, MGC70414 antibody, ACBD1 antibody, Gaba Receptor Modulator Acyl-Coenzyme A Binding Protein antibody, CCK-RP antibody, EP antibody, Diazepam Binding Inhibitor antibody, ACBP antibody
Cross Reactivity Human
Applications WB
Immunogen DBI antibody was raised using a synthetic peptide corresponding to a region with amino acids MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDF
Assay Information DBI Blocking Peptide, catalog no. 33R-6477, is also available for use as a blocking control in assays to test for specificity of this DBI antibody

Images

Western Blot analysis using DBI antibody (70R-2557)

DBI antibody (70R-2557) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 10 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DBI antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DBI is diazepam binding inhibitor. The protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. DBI is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DBI antibody (70R-2557) | DBI antibody (70R-2557) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors