DCLRE1C antibody (70R-2289)

Rabbit polyclonal DCLRE1C antibody

Synonyms Polyclonal DCLRE1C antibody, Anti-DCLRE1C antibody, RS-SCID antibody, Pso2 Homolog S. Cerevisiae antibody, Dna Cross-Link Repair 1C antibody, FLJ11360 antibody, DCLRE1, DCLRE-1, DCLREC1C antibody, SCIDA antibody, A-SCID antibody, FLJ36438 antibody, DCLRE 1 antibody, DCLRE 1, DCLRE-1 antibody, SNM1C antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DCLRE1C antibody was raised using a synthetic peptide corresponding to a region with amino acids SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL
Assay Information DCLRE1C Blocking Peptide, catalog no. 33R-8799, is also available for use as a blocking control in assays to test for specificity of this DCLRE1C antibody


Western Blot analysis using DCLRE1C antibody (70R-2289)

DCLRE1C antibody (70R-2289) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 78 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCLRE1C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DCLRE1C is a nuclear protein that is involved in V(D)J recombination and DNA repair. The protein has single-strand-specific 5'-3' exonuclease activity; it also exhibits endonuclease activity on 5' and 3' overhangs and hairpins when complexed with protein kinase, DNA-activated, catalytic polypeptide. Mutations in this gene cause Athabascan-type severe combined immunodeficiency (SCIDA).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DCLRE1C antibody (70R-2289) | DCLRE1C antibody (70R-2289) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors