DCUN1D3 antibody (70R-3750)

Rabbit polyclonal DCUN1D3 antibody

Synonyms Polyclonal DCUN1D3 antibody, Anti-DCUN1D3 antibody, DCUN-1 antibody, DCUN 1, 44M2.4 antibody, DCUN 1 antibody, DCUN-1, MGC48972 antibody, Dcn1 Defective In Cullin Neddylation 1 Domain Containing 3 antibody, FLJ41725 antibody, DKFZp686O0290 antibody, DCUN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DCUN1D3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFV
Assay Information DCUN1D3 Blocking Peptide, catalog no. 33R-5221, is also available for use as a blocking control in assays to test for specificity of this DCUN1D3 antibody

Images

Western Blot analysis using DCUN1D3 antibody (70R-3750)

DCUN1D3 antibody (70R-3750) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCUN1D3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DCUN1D3 contains 1 DCUN1 domain. The exact function of DCUN1D3 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DCUN1D3 antibody (70R-3750) | DCUN1D3 antibody (70R-3750) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors