DDX19B antibody (70R-1388)

Rabbit polyclonal DDX19B antibody

Synonyms Polyclonal DDX19B antibody, Anti-DDX19B antibody, DDX19B, DDXB 19, DDXB-19 antibody, Asp-Glu-Ala-As Box Polypeptide 19B antibody, Dead antibody, DDXB-19, DDXB 19 antibody
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen DDX19B antibody was raised using a synthetic peptide corresponding to a region with amino acids GKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG
Assay Information DDX19B Blocking Peptide, catalog no. 33R-3358, is also available for use as a blocking control in assays to test for specificity of this DDX19B antibody


Western Blot analysis using DDX19B antibody (70R-1388)

DDX19B antibody (70R-1388) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DDX19B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX19B is a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DDX19B antibody (70R-1388) | DDX19B antibody (70R-1388) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors