DDX26B antibody (70R-4737)

Rabbit polyclonal DDX26B antibody

Synonyms Polyclonal DDX26B antibody, Anti-DDX26B antibody, MGC88298 antibody, Dead/H antibody, DDXB-26, DKFZp686G0470 antibody, DDXB 26 antibody, FLJ41215 antibody, Asp-Glu-Ala-Asp/His Box Polypeptide 26B antibody, DDXB 26, DDX26B, DDXB-26 antibody
Cross Reactivity Human
Applications WB
Immunogen DDX26B antibody was raised using a synthetic peptide corresponding to a region with amino acids ASTEPEQLGSVPTDESAITQMCEVTGGRSYCVRTQRMLNQCLESLVQKVQ
Assay Information DDX26B Blocking Peptide, catalog no. 33R-1534, is also available for use as a blocking control in assays to test for specificity of this DDX26B antibody

Images

Western Blot analysis using DDX26B antibody (70R-4737)

DDX26B antibody (70R-4737) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDX26B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of DDX26B protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DDX26B antibody (70R-4737) | DDX26B antibody (70R-4737) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors