DDX27 antibody (70R-4795)

Rabbit polyclonal DDX27 antibody

Synonyms Polyclonal DDX27 antibody, Anti-DDX27 antibody, HSPC259 antibody, RHLP antibody, FLJ12917 antibody, DDX 27, DDX-27 antibody, dJ686N3.1 antibody, PP3241 antibody, FLJ22238 antibody, DDX 27 antibody, DDX-27, DKFZp667N057 antibody, Rrp3p antibody, Dead antibody, MGC163147 antibody, FLJ20596 antibody, MGC1018 antibody, Asp-Glu-Ala-Asp Box Polypeptide 27 antibody, DDX27
Cross Reactivity Human
Applications WB
Immunogen DDX27 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLGLIGTIGEDDEVPVEPESDSGDEEEEGPIVLGRRQKALGKNRSADFNP
Assay Information DDX27 Blocking Peptide, catalog no. 33R-2044, is also available for use as a blocking control in assays to test for specificity of this DDX27 antibody


Western Blot analysis using DDX27 antibody (70R-4795)

DDX27 antibody (70R-4795) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDX27 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX27 is a DEAD box protein, the function of which has not been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DDX27 antibody (70R-4795) | DDX27 antibody (70R-4795) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors