DDX28 antibody (70R-5025)

Rabbit polyclonal DDX28 antibody

Synonyms Polyclonal DDX28 antibody, Anti-DDX28 antibody, DDX28, Dead antibody, DDX-28 antibody, DDX 28 antibody, MDDX28 antibody, DDX-28, Asp-Glu-Ala-Asp Box Polypeptide 28 antibody, FLJ11282 antibody, DDX 28
Cross Reactivity Human
Applications WB
Immunogen DDX28 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQS
Assay Information DDX28 Blocking Peptide, catalog no. 33R-3063, is also available for use as a blocking control in assays to test for specificity of this DDX28 antibody

Images

Western Blot analysis using DDX28 antibody (70R-5025)

DDX28 antibody (70R-5025) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDX28 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX28 is an RNA-dependent ATPase. DDX28 is localized in the mitochondria and the nucleus, and can be transported between the mitochondria and the nucleus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DDX28 antibody (70R-5025) | DDX28 antibody (70R-5025) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors