DDX42 antibody (70R-4789)

Rabbit polyclonal DDX42 antibody

Synonyms Polyclonal DDX42 antibody, Anti-DDX42 antibody, SF3b125 antibody, DDX-42, FLJ43179 antibody, DDX 42 antibody, RHELP antibody, Asp-Glu-Ala-Asp Box Polypeptide 42 antibody, Dead antibody, DDX42, DDX-42 antibody, DDX 42, RNAHP antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DDX42 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM
Assay Information DDX42 Blocking Peptide, catalog no. 33R-7187, is also available for use as a blocking control in assays to test for specificity of this DDX42 antibody

Images

Western Blot analysis using DDX42 antibody (70R-4789)

DDX42 antibody (70R-4789) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 103 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDX42 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DDX42 is a member of the Asp-Glu-Ala-Asp (DEAD) box protein family. Members of this protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DDX42 antibody (70R-4789) | DDX42 antibody (70R-4789) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors