DDX47 antibody (70R-1369)

Rabbit polyclonal DDX47 antibody

Synonyms Polyclonal DDX47 antibody, Anti-DDX47 antibody, DDX47, DDX 47 antibody, Asp-Glu-Ala-Asp Box Polypeptide 47 antibody, Dead antibody, DDX-47 antibody, DDX 47, DDX-47
Cross Reactivity Human
Applications IHC, WB
Immunogen DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids AQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR
Assay Information DDX47 Blocking Peptide, catalog no. 33R-1454, is also available for use as a blocking control in assays to test for specificity of this DDX47 antibody


Immunohistochemical staining using DDX47 antibody (70R-1369)

DDX47 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DDX47 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DDX47 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using DDX47 antibody (70R-1369) | DDX47 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X
  • Western Blot analysis using DDX47 antibody (70R-1369) | DDX47 antibody (70R-1369) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors