DDX52 antibody (70R-4625)

Rabbit polyclonal DDX52 antibody

Synonyms Polyclonal DDX52 antibody, Anti-DDX52 antibody, DDX 52, DDX-52, ROK1 antibody, Asp-Glu-Ala-Asp Box Polypeptide 52 antibody, DDX 52 antibody, DDX-52 antibody, DDX52, Dead antibody
Cross Reactivity Human
Applications WB
Immunogen DDX52 antibody was raised using a synthetic peptide corresponding to a region with amino acids YDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKRE
Assay Information DDX52 Blocking Peptide, catalog no. 33R-10066, is also available for use as a blocking control in assays to test for specificity of this DDX52 antibody


Western Blot analysis using DDX52 antibody (70R-4625)

DDX52 antibody (70R-4625) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDX52 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of DDX52 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DDX52 antibody (70R-4625) | DDX52 antibody (70R-4625) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors