DDX55 antibody (70R-1380)

Rabbit polyclonal DDX55 antibody

Synonyms Polyclonal DDX55 antibody, Anti-DDX55 antibody, Asp-Glu-Ala-Asp Box Polypeptide 55 antibody, DDX55, DDX-55 antibody, Dead antibody, DDX-55, DDX 55 antibody, DDX 55
Cross Reactivity Human,Dog
Applications WB
Immunogen DDX55 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIK
Assay Information DDX55 Blocking Peptide, catalog no. 33R-3374, is also available for use as a blocking control in assays to test for specificity of this DDX55 antibody


Western Blot analysis using DDX55 antibody (70R-1380)

DDX55 antibody (70R-1380) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DDX55 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Anti-DDX55 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Multiple alternatively spliced transcript variants have been found for Anti-DDX55, but the biological validity of only one transcript has been confirmed.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DDX55 antibody (70R-1380) | DDX55 antibody (70R-1380) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors