Desmin antibody (70R-1238)

Rabbit polyclonal Desmin antibody raised against the N terminal of DES

Synonyms Polyclonal Desmin antibody, Anti-Desmin antibody, FLJ41793 antibody, DES antibody, FLJ12025 antibody, FLJ41013 antibody, CMD1I antibody, CSM2 antibody, CSM1 antibody, FLJ39719 antibody
Specificity Desmin antibody was raised against the N terminal of DES
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Desmin antibody was raised using the N terminal of DES corresponding to a region with amino acids PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTR
Assay Information Desmin Blocking Peptide, catalog no. 33R-7209, is also available for use as a blocking control in assays to test for specificity of this Desmin antibody


Western Blot analysis using Desmin antibody (70R-1238)

Desmin antibody (70R-1238) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DES antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DES is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in its gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Desmin antibody (70R-1238) | Desmin antibody (70R-1238) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors