Desmin antibody (70R-3807)

Rabbit polyclonal Desmin antibody raised against the middle region of DES

Synonyms Polyclonal Desmin antibody, Anti-Desmin antibody, FLJ39719 antibody, FLJ41013 antibody, CSM1 antibody, FLJ12025 antibody, CSM2 antibody, CMD1I antibody, DES antibody, FLJ41793 antibody
Specificity Desmin antibody was raised against the middle region of DES
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen Desmin antibody was raised using the middle region of DES corresponding to a region with amino acids MALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKT
Assay Information Desmin Blocking Peptide, catalog no. 33R-5684, is also available for use as a blocking control in assays to test for specificity of this Desmin antibody

Images

Western Blot analysis using Desmin antibody (70R-3807)

Desmin antibody (70R-3807) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DES antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DES is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in its gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Desmin antibody (70R-3807) | Desmin antibody (70R-3807) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors