DFNA5 antibody (70R-1267)

Rabbit polyclonal DFNA5 antibody raised against the C terminal of DFNA5

Synonyms Polyclonal DFNA5 antibody, Anti-DFNA5 antibody, ICERE-1 antibody, DFNA5, DFNA 5, DFNA-5, DFNA 5 antibody, Deafness Autosomal Dominant 5 antibody, DFNA-5 antibody
Specificity DFNA5 antibody was raised against the C terminal of DFNA5
Cross Reactivity Human
Applications IHC, WB
Immunogen DFNA5 antibody was raised using the C terminal of DFNA5 corresponding to a region with amino acids AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR
Assay Information DFNA5 Blocking Peptide, catalog no. 33R-1034, is also available for use as a blocking control in assays to test for specificity of this DFNA5 antibody


Immunohistochemical staining using DFNA5 antibody (70R-1267)

DFNA5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DFNA5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Hearing impairment is a heterogeneous condition with over 40 loci described. DFNA5 is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in its gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using DFNA5 antibody (70R-1267) | DFNA5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using DFNA5 antibody (70R-1267) | DFNA5 antibody (70R-1267) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using DFNA5 antibody (70R-1267) | DFNA5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors