DGCR8 antibody (70R-4730)

Rabbit polyclonal DGCR8 antibody raised against the N terminal of DGCR8

Synonyms Polyclonal DGCR8 antibody, Anti-DGCR8 antibody, DGCRK6 antibody, Gy1 antibody, C22orf12 antibody, Digeorge Syndrome Critical Region Gene 8 antibody
Specificity DGCR8 antibody was raised against the N terminal of DGCR8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DGCR8 antibody was raised using the N terminal of DGCR8 corresponding to a region with amino acids DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR
Assay Information DGCR8 Blocking Peptide, catalog no. 33R-2021, is also available for use as a blocking control in assays to test for specificity of this DGCR8 antibody

Images

Immunohistochemical staining using DGCR8 antibody (70R-4730)

Liver

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 85 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DGCR8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DGCR8 contains 2 DRBM (double-stranded RNA-binding) domains and 1 WW domain. It may play a part in the etiology of the velocardiofacial/DiGeorge syndrome (VCFS/DGS), a developmental disorder characterized by structural and functional palate anomalies, conotruncal cardiac malformations, immunodeficiency, hypocalcemia, and typical facial anomalies.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using DGCR8 antibody (70R-4730) | Liver
  • Western blot analysis using DGCR8 antibody (70R-4730) | Recommended DGCR8 Antibody

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors