DHFRL1 antibody (70R-4081)

Rabbit polyclonal DHFRL1 antibody raised against the middle region of DHFRL1

Synonyms Polyclonal DHFRL1 antibody, Anti-DHFRL1 antibody, FLJ16119 antibody, DHFRP4 antibody, Dihydrofolate Reductase-Like 1 antibody
Specificity DHFRL1 antibody was raised against the middle region of DHFRL1
Cross Reactivity Human
Applications WB
Immunogen DHFRL1 antibody was raised using the middle region of DHFRL1 corresponding to a region with amino acids RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS
Assay Information DHFRL1 Blocking Peptide, catalog no. 33R-7973, is also available for use as a blocking control in assays to test for specificity of this DHFRL1 antibody

Images

Western Blot analysis using DHFRL1 antibody (70R-4081)

DHFRL1 antibody (70R-4081) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHFRL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DHFRL1 may play a role in folate metabolism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DHFRL1 antibody (70R-4081) | DHFRL1 antibody (70R-4081) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors