DHX35 antibody (70R-4797)

Rabbit polyclonal DHX35 antibody

Synonyms Polyclonal DHX35 antibody, Anti-DHX35 antibody, FLJ22759 antibody, DHX-35 antibody, Asp-Glu-Ala-His Box Polypeptide 35 antibody, Deah antibody, C20orf15 antibody, DHX 35, DHX-35, DHX35, DDX35 antibody, DHX 35 antibody, KAIA0875 antibody
Cross Reactivity Human
Applications WB
Immunogen DHX35 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ
Assay Information DHX35 Blocking Peptide, catalog no. 33R-5605, is also available for use as a blocking control in assays to test for specificity of this DHX35 antibody


Western Blot analysis using DHX35 antibody (70R-4797)

DHX35 antibody (70R-4797) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHX35 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of DHX35 which is a member of this family, has not been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DHX35 antibody (70R-4797) | DHX35 antibody (70R-4797) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors