DIP2A antibody (70R-4403)

Rabbit polyclonal DIP2A antibody

Synonyms Polyclonal DIP2A antibody, Anti-DIP2A antibody, DIP2A, DIPA 2, DIPA-2, DIP2 antibody, DIPA 2 antibody, DIPA-2 antibody, C21orf106 antibody, Dip2 Disco-Interacting Protein 2 Homolog A antibody
Cross Reactivity Human
Applications WB
Immunogen DIP2A antibody was raised using a synthetic peptide corresponding to a region with amino acids PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL
Assay Information DIP2A Blocking Peptide, catalog no. 33R-7196, is also available for use as a blocking control in assays to test for specificity of this DIP2A antibody

Images

Western Blot analysis using DIP2A antibody (70R-4403)

DIP2A antibody (70R-4403) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 170 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DIP2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene may be involved in axon patterning in the central nervous system. This gene is not highly expressed. Several transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DIP2A antibody (70R-4403) | DIP2A antibody (70R-4403) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors