DKFZP761C169 antibody (70R-2280)

Rabbit polyclonal DKFZP761C169 antibody raised against the N terminal Of Dkfzp761C169

Synonyms Polyclonal DKFZP761C169 antibody, Anti-DKFZP761C169 antibody
Specificity DKFZP761C169 antibody was raised against the N terminal Of Dkfzp761C169
Cross Reactivity Human
Applications IHC, WB
Immunogen DKFZP761C169 antibody was raised using the N terminal Of Dkfzp761C169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP
Assay Information DKFZP761C169 Blocking Peptide, catalog no. 33R-7991, is also available for use as a blocking control in assays to test for specificity of this DKFZP761C169 antibody


Immunohistochemical staining using DKFZP761C169 antibody (70R-2280)

DKFZP761C169 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (lndicated with Arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DKFZP761C169 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Vasculin is a novel vascular protein differentially expressed in human atherogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using DKFZP761C169 antibody (70R-2280) | DKFZP761C169 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (lndicated with Arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using DKFZP761C169 antibody (70R-2280) | DKFZP761C169 antibody (70R-2280) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors