DLAT antibody (70R-1115)

Rabbit polyclonal DLAT antibody

Synonyms Polyclonal DLAT antibody, Anti-DLAT antibody, Dihydrolipoamide S-Acetyltransferase antibody, PDC-E2 antibody, DLTA antibody, PDCE2 antibody, E2 Component Of Pyruvate Dehydrogenase Complex antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen DLAT antibody was raised using a synthetic peptide corresponding to a region with amino acids WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR
Assay Information DLAT Blocking Peptide, catalog no. 33R-10028, is also available for use as a blocking control in assays to test for specificity of this DLAT antibody


Immunohistochemical staining using DLAT antibody (70R-1115)

DLAT antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DLAT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using DLAT antibody (70R-1115) | DLAT antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using DLAT antibody (70R-1115) | DLAT antibody (70R-1115) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors