DLAT antibody (70R-2503)

Rabbit polyclonal DLAT antibody raised against the C terminal of DLAT

Synonyms Polyclonal DLAT antibody, Anti-DLAT antibody, Dihydrolipoamide S-Acetyltransferase antibody, DLTA antibody, PDC-E2 antibody, PDCE2 antibody
Specificity DLAT antibody was raised against the C terminal of DLAT
Cross Reactivity Human,Mouse,Rat,C.elegans
Applications WB
Immunogen DLAT antibody was raised using the C terminal of DLAT corresponding to a region with amino acids DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA
Assay Information DLAT Blocking Peptide, catalog no. 33R-2227, is also available for use as a blocking control in assays to test for specificity of this DLAT antibody


Western Blot analysis using DLAT antibody (70R-2503)

DLAT antibody (70R-2503) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DLAT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DLAT antibody (70R-2503) | DLAT antibody (70R-2503) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors