DLC1 antibody (70R-1946)

Rabbit polyclonal DLC1 antibody raised against the C terminal of DLC1

Synonyms Polyclonal DLC1 antibody, Anti-DLC1 antibody, FLJ21120 antibody, HP antibody, Deleted In LiverCancer 1 antibody, p122-RhoGAP antibody, ARHGAP7 antibody, STARD12 antibody
Specificity DLC1 antibody was raised against the C terminal of DLC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
Assay Information DLC1 Blocking Peptide, catalog no. 33R-6752, is also available for use as a blocking control in assays to test for specificity of this DLC1 antibody

Images

Western Blot analysis using DLC1 antibody (70R-1946)

DLC1 antibody (70R-1946) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DLC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is deleted in the primary tumor of hepatocellular carcinoma. It maps to 8p22-p21.3, a region frequently deleted in solid tumors. It is suggested that this gene is a candidate tumor suppressor gene for human liver cancer, as well as for prostate, lung, colorectal, and breast cancers. DLC1 functions as a GTPase-activating protein specific for Rho and an activator of PLCD1 in vivo and induces morphological changes and detachment through cytoskeletal reorganization.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DLC1 antibody (70R-1946) | DLC1 antibody (70R-1946) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors