DLD antibody (70R-2451)

Rabbit polyclonal DLD antibody raised against the middle region of DLD

Synonyms Polyclonal DLD antibody, Anti-DLD antibody, E3 antibody, DLDH antibody, LAD antibody, GCSL antibody, Dihydrolipoamide Dehydrogenase antibody, PHE3 antibody
Specificity DLD antibody was raised against the middle region of DLD
Cross Reactivity Human,Dog
Applications WB
Immunogen DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF
Assay Information DLD Blocking Peptide, catalog no. 33R-1194, is also available for use as a blocking control in assays to test for specificity of this DLD antibody

Images

Western Blot analysis using DLD antibody (70R-2451)

DLD antibody (70R-2451) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DLD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DLD is the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DLD antibody (70R-2451) | DLD antibody (70R-2451) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors