DNA2L antibody (70R-4613)

Rabbit polyclonal DNA2L antibody raised against the middle region of Dna2L

Synonyms Polyclonal DNA2L antibody, Anti-DNA2L antibody, DNAL-2 antibody, DNA2L antibody, DNAL-2, KIAA0083 antibody, DNA2L, DNAL 2 antibody, DNAL 2, FLJ10063 antibody, MGC133297 antibody
Specificity DNA2L antibody was raised against the middle region of Dna2L
Cross Reactivity Human
Applications WB
Immunogen DNA2L antibody was raised using the middle region of Dna2L corresponding to a region with amino acids KLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVSNVTE
Assay Information DNA2L Blocking Peptide, catalog no. 33R-4506, is also available for use as a blocking control in assays to test for specificity of this DNA2L antibody

Images

Western Blot analysis using DNA2L antibody (70R-4613)

DNA2L antibody (70R-4613) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNA2L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNA2L belongs to the DNA2/NAM7 helicase family. It may function in chromosomal DNA replication.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DNA2L antibody (70R-4613) | DNA2L antibody (70R-4613) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors