DNAJB6 antibody (70R-2575)

Rabbit polyclonal DNAJB6 antibody

Synonyms Polyclonal DNAJB6 antibody, Anti-DNAJB6 antibody, MGC1152 antibody, MSJ-1 antibody, DKFZp566D0824 antibody, FLJ42837 antibody, DnaJ antibody, HSJ-2 antibody, Hsp40 Homolog Subfamily B 6 antibody, HHDJ1 antibody, MGC117297 antibody, HSJ2 antibody, MRJ antibody, Dnaj antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DNAJB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDS
Assay Information DNAJB6 Blocking Peptide, catalog no. 33R-7052, is also available for use as a blocking control in assays to test for specificity of this DNAJB6 antibody


Western Blot analysis using DNAJB6 antibody (70R-2575)

DNAJB6 antibody (70R-2575) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNAJB6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNAJB6 is a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DNAJB6 antibody (70R-2575) | DNAJB6 antibody (70R-2575) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors