DND1 antibody (70R-4729)

Rabbit polyclonal DND1 antibody

Synonyms Polyclonal DND1 antibody, Anti-DND1 antibody, MGC34750 antibody, DND 1 antibody, DND1, RBMS4 antibody, DND-1 antibody, DND 1, DND-1, Dead End Homolog 1 antibody
Cross Reactivity Human
Applications WB
Immunogen DND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES
Assay Information DND1 Blocking Peptide, catalog no. 33R-3840, is also available for use as a blocking control in assays to test for specificity of this DND1 antibody


Western Blot analysis using DND1 antibody (70R-4729)

DND1 antibody (70R-4729) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DND1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DND1 contains 2 RRM (RNA recognition motif) domains. It may play a role during primordial germ cell (PGC) development. However, DND1 does not seem to be essential for PGC migration.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DND1 antibody (70R-4729) | DND1 antibody (70R-4729) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors