DNMT3B antibody (70R-2283)

Rabbit polyclonal DNMT3B antibody

Synonyms Polyclonal DNMT3B antibody, Anti-DNMT3B antibody, DNMTB-3, DNMT3B, DNMTB 3, ICF antibody, DNMTB-3 antibody, Cytosine-5-Methyltransferase 3 Beta antibody, M.HsaIIIB antibody, Dna antibody, DNMTB 3 antibody
Cross Reactivity Human
Applications WB
Immunogen DNMT3B antibody was raised using a synthetic peptide corresponding to a region with amino acids GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC
Assay Information DNMT3B Blocking Peptide, catalog no. 33R-3607, is also available for use as a blocking control in assays to test for specificity of this DNMT3B antibody


Western Blot analysis using DNMT3B antibody (70R-2283)

DNMT3B antibody (70R-2283) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNMT3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNMT3B is required for genome wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. DNMT3B may preferentially methylate nucleosomal DNA within the nucleosome core region. DNMT3B may function as transcriptional co-repressor by associating with CBX4 and independently of DNA methylation. DNMT3B seems to be involved in gene silencing. In association with DNMT1 and via the recruitment of CTCFL/BORIS, DNMT3B is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DNMT3B antibody (70R-2283) | DNMT3B antibody (70R-2283) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors