DPH4 antibody (70R-4199)

Rabbit polyclonal DPH4 antibody raised against the N terminal Of Dph4

Synonyms Polyclonal DPH4 antibody, Anti-DPH4 antibody, JJJ3 antibody, ZCSL3 antibody
Specificity DPH4 antibody was raised against the N terminal Of Dph4
Cross Reactivity Human
Applications WB
Immunogen DPH4 antibody was raised using the N terminal Of Dph4 corresponding to a region with amino acids MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAG
Assay Information DPH4 Blocking Peptide, catalog no. 33R-6225, is also available for use as a blocking control in assays to test for specificity of this DPH4 antibody

Images

Western Blot analysis using DPH4 antibody (70R-4199)

DPH4 antibody (70R-4199) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPH4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DPH4 antibody (70R-4199) | DPH4 antibody (70R-4199) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors