DPP3 antibody (70R-3626)

Rabbit polyclonal DPP3 antibody raised against the N terminal of DPP3

Synonyms Polyclonal DPP3 antibody, Anti-DPP3 antibody, DPP3, DPP-3, DPPIII antibody, Dipeptidyl-Peptidase 3 antibody, DPP-3 antibody, FLJ22331 antibody, DPP 3 antibody, DPP 3, FLJ11387 antibody
Specificity DPP3 antibody was raised against the N terminal of DPP3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DPP3 antibody was raised using the N terminal of DPP3 corresponding to a region with amino acids SRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEE
Assay Information DPP3 Blocking Peptide, catalog no. 33R-8738, is also available for use as a blocking control in assays to test for specificity of this DPP3 antibody


Western Blot analysis using DPP3 antibody (70R-3626)

DPP3 antibody (70R-3626) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DPP3 is a protein that is a member of the S9B family in clan SC of the serine proteases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DPP3 antibody (70R-3626) | DPP3 antibody (70R-3626) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors