DPYS antibody (70R-1174)

Rabbit polyclonal DPYS antibody raised against the middle region of DPYS

Synonyms Polyclonal DPYS antibody, Anti-DPYS antibody, DHP antibody, Dihydropyrimidinase antibody, DHPase antibody
Specificity DPYS antibody was raised against the middle region of DPYS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DPYS antibody was raised using the middle region of DPYS corresponding to a region with amino acids LRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVN
Assay Information DPYS Blocking Peptide, catalog no. 33R-5375, is also available for use as a blocking control in assays to test for specificity of this DPYS antibody

Images

Western Blot analysis using DPYS antibody (70R-1174)

DPYS antibody (70R-1174) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DPYS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DPYS antibody (70R-1174) | DPYS antibody (70R-1174) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors