DTNB antibody (70R-3432)

Rabbit polyclonal DTNB antibody raised against the C terminal of DTNB

Synonyms Polyclonal DTNB antibody, Anti-DTNB antibody, MGC17163 antibody, Dystrobrevin Beta antibody, MGC57126 antibody
Specificity DTNB antibody was raised against the C terminal of DTNB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DTNB antibody was raised using the C terminal of DTNB corresponding to a region with amino acids ASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEEL
Assay Information DTNB Blocking Peptide, catalog no. 33R-1524, is also available for use as a blocking control in assays to test for specificity of this DTNB antibody

Images

Western Blot analysis using DTNB antibody (70R-3432)

DTNB antibody (70R-3432) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DTNB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DTNB is dystrobrevin beta, a component of the dystrophin-associated protein complex (DPC). The DPC consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and dystrobrevin alpha and beta. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Dystrobrevin beta is thought to interact with syntrophin and the DP71 short form of dystrophin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DTNB antibody (70R-3432) | DTNB antibody (70R-3432) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors