Dynactin 2 antibody (70R-5500)

Rabbit polyclonal Dynactin 2 antibody

Synonyms Polyclonal Dynactin 2 antibody, Anti-Dynactin 2 antibody, DCTN2 antibody, P50 antibody, DYNAMITIN antibody, RBP50 antibody, DCTN50 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Dynactin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHI
Assay Information Dynactin 2 Blocking Peptide, catalog no. 33R-1100, is also available for use as a blocking control in assays to test for specificity of this Dynactin 2 antibody


Western Blot analysis using Dynactin 2 antibody (70R-5500)

Dynactin 2 antibody (70R-5500) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCTN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DCTN2 is a 50 kDa subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Dynactin 2 antibody (70R-5500) | Dynactin 2 antibody (70R-5500) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors