DYNC1I1 antibody (70R-4124)

Rabbit polyclonal DYNC1I1 antibody raised against the N terminal of DYNC1I1

Synonyms Polyclonal DYNC1I1 antibody, Anti-DYNC1I1 antibody, DNCI1 antibody, Dynein Cytoplasmic 1 Intermediate Chain 1 antibody, DNCIC1 antibody
Specificity DYNC1I1 antibody was raised against the N terminal of DYNC1I1
Cross Reactivity Human,Mouse
Applications WB
Immunogen DYNC1I1 antibody was raised using the N terminal of DYNC1I1 corresponding to a region with amino acids IREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISP
Assay Information DYNC1I1 Blocking Peptide, catalog no. 33R-4130, is also available for use as a blocking control in assays to test for specificity of this DYNC1I1 antibody

Images

Western Blot analysis using DYNC1I1 antibody (70R-4124)

DYNC1I1 antibody (70R-4124) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DYNC1I1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DYNC1I1 belongs to the dynein intermediate chain family. It contains 7 WD repeats. The intermediate chains seem to help dynein bind to dynactin 150 kDa component. DYNC1I1 may play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DYNC1I1 antibody (70R-4124) | DYNC1I1 antibody (70R-4124) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors