DYNC1I1 antibody (70R-4125)

Rabbit polyclonal DYNC1I1 antibody raised against the N terminal of DYNC1I1

Synonyms Polyclonal DYNC1I1 antibody, Anti-DYNC1I1 antibody, Dynein Cytoplasmic 1 Intermediate Chain 1 antibody, DNCIC1 antibody, DNCI1 antibody
Specificity DYNC1I1 antibody was raised against the N terminal of DYNC1I1
Cross Reactivity Human,Mouse
Applications WB
Immunogen DYNC1I1 antibody was raised using the N terminal of DYNC1I1 corresponding to a region with amino acids GSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFL
Assay Information DYNC1I1 Blocking Peptide, catalog no. 33R-3577, is also available for use as a blocking control in assays to test for specificity of this DYNC1I1 antibody


Western Blot analysis using DYNC1I1 antibody (70R-4125)

DYNC1I1 antibody (70R-4125) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DYNC1I1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The aldehyde dehydrogenases are a family of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. ALDH3B1 is highly expressed in kidney and lung.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DYNC1I1 antibody (70R-4125) | DYNC1I1 antibody (70R-4125) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors