DYRK1A antibody (70R-1962)

Rabbit polyclonal DYRK1A antibody

Synonyms Polyclonal DYRK1A antibody, Anti-DYRK1A antibody, DYRK antibody, HP86 antibody, MNBH antibody, Dual-Specificity Tyrosine Y-phosphorylation regulated kinase 1A antibody, DYRK1 antibody, MNB antibody
Cross Reactivity Human
Applications WB
Immunogen DYRK1A antibody was raised using a synthetic peptide corresponding to a region with amino acids INEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWM
Assay Information DYRK1A Blocking Peptide, catalog no. 33R-4071, is also available for use as a blocking control in assays to test for specificity of this DYRK1A antibody


Western Blot analysis using DYRK1A antibody (70R-1962)

DYRK1A antibody (70R-1962) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 85 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DYRK1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DYRK1A antibody (70R-1962) | DYRK1A antibody (70R-1962) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors