DYSFIP1 antibody (70R-4114)

Rabbit polyclonal DYSFIP1 antibody raised against the middle region of DYSFIP1

Synonyms Polyclonal DYSFIP1 antibody, Anti-DYSFIP1 antibody, MGC138299 antibody, Dysferlin Interacting Protein 1 antibody
Specificity DYSFIP1 antibody was raised against the middle region of DYSFIP1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DYSFIP1 antibody was raised using the middle region of DYSFIP1 corresponding to a region with amino acids DHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVK
Assay Information DYSFIP1 Blocking Peptide, catalog no. 33R-1976, is also available for use as a blocking control in assays to test for specificity of this DYSFIP1 antibody


Western Blot analysis using DYSFIP1 antibody (70R-4114)

DYSFIP1 antibody (70R-4114) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DYSFIP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of DYSFIP1 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DYSFIP1 antibody (70R-4114) | DYSFIP1 antibody (70R-4114) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors