EBI3 antibody (70R-3648)

Rabbit polyclonal EBI3 antibody raised against the middle region of EBI3

Synonyms Polyclonal EBI3 antibody, Anti-EBI3 antibody, Epstein-Barr Virus Induced 3 antibody
Specificity EBI3 antibody was raised against the middle region of EBI3
Cross Reactivity Human
Applications WB
Immunogen EBI3 antibody was raised using the middle region of EBI3 corresponding to a region with amino acids TAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWP
Assay Information EBI3 Blocking Peptide, catalog no. 33R-8990, is also available for use as a blocking control in assays to test for specificity of this EBI3 antibody


Western Blot analysis using EBI3 antibody (70R-3648)

EBI3 antibody (70R-3648) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EBI3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EBI3 antibody (70R-3648) | EBI3 antibody (70R-3648) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
View Our Distributors