ECH1 antibody (70R-1104)

Rabbit polyclonal ECH1 antibody raised against the N terminal of ECH1

Synonyms Polyclonal ECH1 antibody, Anti-ECH1 antibody, Enoyl Coenzyme A Hydratase 1 Peroxisomal antibody, HPXEL antibody
Specificity ECH1 antibody was raised against the N terminal of ECH1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ECH1 antibody was raised using the N terminal of ECH1 corresponding to a region with amino acids PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDA
Assay Information ECH1 Blocking Peptide, catalog no. 33R-7014, is also available for use as a blocking control in assays to test for specificity of this ECH1 antibody


Western Blot analysis using ECH1 antibody (70R-1104)

ECH1 antibody (70R-1104) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ECH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ECH1 is a member of the hydratase/isomerase superfamily. ECH1 shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The protein contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ECH1 antibody (70R-1104) | ECH1 antibody (70R-1104) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors