ECHDC1 antibody (70R-2161)

Rabbit polyclonal ECHDC1 antibody raised against the middle region of ECHDC1

Synonyms Polyclonal ECHDC1 antibody, Anti-ECHDC1 antibody, DKFZp762M1110 antibody, dJ351K20.2 antibody, Enoyl Coenzyme A Hydratase Domain Containing 1 antibody
Specificity ECHDC1 antibody was raised against the middle region of ECHDC1
Cross Reactivity Human
Applications WB
Immunogen ECHDC1 antibody was raised using the middle region of ECHDC1 corresponding to a region with amino acids GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDG
Assay Information ECHDC1 Blocking Peptide, catalog no. 33R-3646, is also available for use as a blocking control in assays to test for specificity of this ECHDC1 antibody


Western Blot analysis using ECHDC1 antibody (70R-2161)

ECHDC1 antibody (70R-2161) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ECHDC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ECHDC1 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC1 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ECHDC1 antibody (70R-2161) | ECHDC1 antibody (70R-2161) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors