ECHDC3 antibody (70R-1013)

Rabbit polyclonal ECHDC3 antibody raised against the N terminal of ECHDC3

Synonyms Polyclonal ECHDC3 antibody, Anti-ECHDC3 antibody, RP11-401F24.3 antibody, Enoyl Coenzyme A Hydratase Domain Containing 3 antibody, FLJ20909 antibody
Specificity ECHDC3 antibody was raised against the N terminal of ECHDC3
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen ECHDC3 antibody was raised using the N terminal of ECHDC3 corresponding to a region with amino acids SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY
Assay Information ECHDC3 Blocking Peptide, catalog no. 33R-8576, is also available for use as a blocking control in assays to test for specificity of this ECHDC3 antibody

Images

Western Blot analysis using ECHDC3 antibody (70R-1013)

ECHDC3 antibody (70R-1013) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ECHDC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ECHDC3 possesses catalytic activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ECHDC3 antibody (70R-1013) | ECHDC3 antibody (70R-1013) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors