ECHS1 antibody (70R-1098)

Rabbit polyclonal ECHS1 antibody raised against the middle region of ECHS1

Synonyms Polyclonal ECHS1 antibody, Anti-ECHS1 antibody, SCEH antibody, Enoyl Coenzyme A Hydratase Short Chain 1 Mitochondrial antibody
Specificity ECHS1 antibody was raised against the middle region of ECHS1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen ECHS1 antibody was raised using the middle region of ECHS1 corresponding to a region with amino acids RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIA
Assay Information ECHS1 Blocking Peptide, catalog no. 33R-7826, is also available for use as a blocking control in assays to test for specificity of this ECHS1 antibody

Images

Western Blot analysis using ECHS1 antibody (70R-1098)

ECHS1 antibody (70R-1098) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ECHS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ECHS1 functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. ECHS1 is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ECHS1 antibody (70R-1098) | ECHS1 antibody (70R-1098) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors