EEF1B2 antibody (70R-2143)

Rabbit polyclonal EEF1B2 antibody raised against the middle region of EEF1B2

Synonyms Polyclonal EEF1B2 antibody, Anti-EEF1B2 antibody, Eukaryotic Translation Elongation Factor 1 Beta 2 antibody, EEF1B antibody, EEF1B1 antibody, EF1B antibody
Specificity EEF1B2 antibody was raised against the middle region of EEF1B2
Cross Reactivity Human
Applications WB
Immunogen EEF1B2 antibody was raised using the middle region of EEF1B2 corresponding to a region with amino acids VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE
Assay Information EEF1B2 Blocking Peptide, catalog no. 33R-9624, is also available for use as a blocking control in assays to test for specificity of this EEF1B2 antibody

Images

Western Blot analysis using EEF1B2 antibody (70R-2143)

EEF1B2 antibody (70R-2143) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EEF1B2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EEF1B2 is a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EEF1B2 antibody (70R-2143) | EEF1B2 antibody (70R-2143) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors