EFCAB3 antibody (70R-4544)

Rabbit polyclonal EFCAB3 antibody raised against the N terminal of EFCAB3

Synonyms Polyclonal EFCAB3 antibody, Anti-EFCAB3 antibody, MGC126801 antibody, FLJ25818 antibody, Ef-Hand Calcium Binding Domain 3 antibody, MGC126827 antibody
Specificity EFCAB3 antibody was raised against the N terminal of EFCAB3
Cross Reactivity Human
Applications WB
Immunogen EFCAB3 antibody was raised using the N terminal of EFCAB3 corresponding to a region with amino acids MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMA
Assay Information EFCAB3 Blocking Peptide, catalog no. 33R-5801, is also available for use as a blocking control in assays to test for specificity of this EFCAB3 antibody


Western Blot analysis using EFCAB3 antibody (70R-4544)

EFCAB3 antibody (70R-4544) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EFCAB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EFCAB3 antibody (70R-4544) | EFCAB3 antibody (70R-4544) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors