EFEMP1 antibody (70R-5350)

Rabbit polyclonal EFEMP1 antibody raised against the middle region of EFEMP1

Synonyms Polyclonal EFEMP1 antibody, Anti-EFEMP1 antibody, MTLV antibody, DHRD antibody, FBNL antibody, S1-5 antibody, FBLN3 antibody, FLJ35535 antibody, DRAD antibody, MGC111353 antibody, Egf-Containing Fibulin-Like Extracellular Matrix Protein 1 antibody, MLVT antibody
Specificity EFEMP1 antibody was raised against the middle region of EFEMP1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EFEMP1 antibody was raised using the middle region of EFEMP1 corresponding to a region with amino acids KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV
Assay Information EFEMP1 Blocking Peptide, catalog no. 33R-4746, is also available for use as a blocking control in assays to test for specificity of this EFEMP1 antibody


Western Blot analysis using EFEMP1 antibody (70R-5350)

EFEMP1 antibody (70R-5350) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EFEMP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EFEMP1 genepans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EFEMP1 antibody (70R-5350) | EFEMP1 antibody (70R-5350) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors