EFHA2 antibody (70R-4269)

Rabbit polyclonal EFHA2 antibody raised against the N terminal of EFHA2

Synonyms Polyclonal EFHA2 antibody, Anti-EFHA2 antibody, Ef-Hand Domain Family Member A2 antibody, DKFZp313A0139 antibody
Specificity EFHA2 antibody was raised against the N terminal of EFHA2
Cross Reactivity Human
Applications WB
Immunogen EFHA2 antibody was raised using the N terminal of EFHA2 corresponding to a region with amino acids AAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIP
Assay Information EFHA2 Blocking Peptide, catalog no. 33R-1005, is also available for use as a blocking control in assays to test for specificity of this EFHA2 antibody


Western Blot analysis using EFHA2 antibody (70R-4269)

EFHA2 antibody (70R-4269) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EFHA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of EFHA protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EFHA2 antibody (70R-4269) | EFHA2 antibody (70R-4269) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors