EGLN3 antibody (70R-2564)

Rabbit polyclonal EGLN3 antibody

Synonyms Polyclonal EGLN3 antibody, Anti-EGLN3 antibody, HIFPH3 antibody, FLJ21620 antibody, MGC125999 antibody, Egl Nine Homolog 3 antibody, MGC125998 antibody, PHD3 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT
Assay Information EGLN3 Blocking Peptide, catalog no. 33R-3129, is also available for use as a blocking control in assays to test for specificity of this EGLN3 antibody

Images

Western Blot analysis using EGLN3 antibody (70R-2564)

EGLN3 antibody (70R-2564) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EGLN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EGLN3 catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates HIF-1 alpha at 'Pro-564', and HIF-2 alpha. EGLN3 functions as a cellular oxygen sensor and, under normoxic conditions, targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. It may play a role in cell growth regulation in muscle cells and in apoptosis in neuronal tissue. EGLN3 promotes cell death through a caspase-dependent mechanism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EGLN3 antibody (70R-2564) | EGLN3 antibody (70R-2564) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors