EIF1AX antibody (70R-5014)

Rabbit polyclonal EIF1AX antibody raised against the middle region of EIF1AX

Synonyms Polyclonal EIF1AX antibody, Anti-EIF1AX antibody, EIFAX-1, EIFAX 1 antibody, EIF1A antibody, EIF4C antibody, Eukaryotic Translation Initiation Factor 1A X-Linked antibody, eIF-1A antibody, eIF-4C antibody, EIFAX 1, EIF1AX, EIFAX-1 antibody
Specificity EIF1AX antibody was raised against the middle region of EIF1AX
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EIF1AX antibody was raised using the middle region of EIF1AX corresponding to a region with amino acids KYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDD
Assay Information EIF1AX Blocking Peptide, catalog no. 33R-4747, is also available for use as a blocking control in assays to test for specificity of this EIF1AX antibody

Images

Western Blot analysis using EIF1AX antibody (70R-5014)

EIF1AX antibody (70R-5014) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF1AX antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EIF1AX antibody (70R-5014) | EIF1AX antibody (70R-5014) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors